PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00111013001
Common NameGSBRNA2T00111013001, LOC106452547
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 172aa    MW: 18692.4 Da    PI: 7.0967
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00111013001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.55.2e-39111101100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+l+r+C++ C++ap+f ++++ +fa vhk+FGasnv+kll+++pee+r+++++sl+yeA++r++dPvyG++g i +lq+++ +l
  GSBRNA2T00111013001  11 SCAACKLLKRRCTPTCIFAPHFRSSDQITFAKVHKVFGASNVSKLLSEVPEEQRQETVNSLAYEADVRLKDPVYGCIGAIASLQKKMLEL 100
                          6***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          ++++a+++++
  GSBRNA2T00111013001 101 QHDIAVARNR 110
                          *****99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.510111IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-3811108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MRGHEPRSSS SCAACKLLKR RCTPTCIFAP HFRSSDQITF AKVHKVFGAS NVSKLLSEVP  60
EEQRQETVNS LAYEADVRLK DPVYGCIGAI ASLQKKMLEL QHDIAVARNR LLAHNAAGGV  120
NNNNSHVLLS PLDDSPQLAA FLDLVPYSDL MLLDGSGLDA YLFDIGQPPF V*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00111013001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738451e-132AB473845.1 Arabidopsis thaliana ASL12 mRNA for ASYMMETRIC LEAVES2-like 12 protein, complete cds.
GenBankAC0733951e-132AC073395.6 Arabidopsis thaliana chromosome 3 BAC F11B9 genomic sequence, complete sequence.
GenBankAC2546081e-132AC254608.1 Capsella rubella clone CAP16-D12, complete sequence.
GenBankATAC0099911e-132AC009991.5 Arabidopsis thaliana chromosome III BAC F9F8 genomic sequence, complete sequence.
GenBankCP0026861e-132CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013750153.11e-125PREDICTED: LOB domain-containing protein 21
RefseqXP_013587709.11e-125PREDICTED: LOB domain-containing protein 21
SwissprotQ9SRL81e-106LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A078EJR11e-125A0A078EJR1_BRANA; BnaC05g42060D protein
TrEMBLA0A0D3CLA01e-125A0A0D3CLA0_BRAOL; Uncharacterized protein
STRINGBra034867.1-P1e-110(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM102552735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.12e-92LOB domain-containing protein 21
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]